HPA031433

EPHA8 antibody from Sigma-Aldrich
EEK, Hek3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031433
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA031433, RRID:AB_10601371
Product name
Anti-EPHA8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA031433
Antibody type
Polyclonal
Antigen
EPH receptor A8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHH
PPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASR
IHIEKIIGSGDSG
Storage
-20C
Provider Type Product Number
- No reagents -