Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022943-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022943-M08, RRID:AB_581833
- Product name
- DKK1 monoclonal antibody (M08), clone 2B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant DKK1.
- Antigen sequence
MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNS
VLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPG
GNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGD
AGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVS
SDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLS
SKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKIC
KPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSC
RIQKDHHQASNSSRLHTCQRH- Isotype
- IgG
- Antibody clone number
- 2B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references High dickkopf-1 levels in sera and leukocytes from children with 21-hydroxylase deficiency on chronic glucocorticoid treatment.
Brunetti G, Faienza MF, Piacente L, Ventura A, Oranger A, Carbone C, Benedetto AD, Colaianni G, Gigante M, Mori G, Gesualdo L, Colucci S, Cavallo L, Grano M
American journal of physiology. Endocrinology and metabolism 2013 Mar 1;304(5):E546-54
American journal of physiology. Endocrinology and metabolism 2013 Mar 1;304(5):E546-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DKK1 monoclonal antibody (M08), clone 2B12 Western Blot analysis of DKK1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of DKK1 transfected lysate using anti-DKK1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DKK1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol