Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022943-M11 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022943-M11, RRID:AB_581832
- Product name
- DKK1 monoclonal antibody (M11), clone 2A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant DKK1.
- Antigen sequence
MMALGAAGATRVSVAMVAAALGGHPLLGVSATLNS
VLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPG
GNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGD
AGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVS
SDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLS
SKMYHTTGQEGSVCLRSSDCASGLCCARHFWSKIC
KPVLKGGQVCTKHRRKGSHGLEIFQRCYCGEGLSC
RIQKDHHQASNSSRLHTCQRH- Isotype
- IgG
- Antibody clone number
- 2A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Genetic grouping of medulloblastomas by representative markers in pathologic diagnosis.
Molecular subgroups of medulloblastoma: the current consensus.
Prokineticin 1 induces Dickkopf 1 expression and regulates cell proliferation and decidualization in the human endometrium.
Bone and bone marrow pro-osteoclastogenic cytokines are up-regulated in osteoporosis fragility fractures.
Carbonic anhydrase IX (CA9) modulates tumor-associated cell migration and invasion.
Min HS, Lee JY, Kim SK, Park SH
Translational oncology 2013 Jun;6(3):265-72
Translational oncology 2013 Jun;6(3):265-72
Molecular subgroups of medulloblastoma: the current consensus.
Taylor MD, Northcott PA, Korshunov A, Remke M, Cho YJ, Clifford SC, Eberhart CG, Parsons DW, Rutkowski S, Gajjar A, Ellison DW, Lichter P, Gilbertson RJ, Pomeroy SL, Kool M, Pfister SM
Acta neuropathologica 2012 Apr;123(4):465-72
Acta neuropathologica 2012 Apr;123(4):465-72
Prokineticin 1 induces Dickkopf 1 expression and regulates cell proliferation and decidualization in the human endometrium.
Macdonald LJ, Sales KJ, Grant V, Brown P, Jabbour HN, Catalano RD
Molecular human reproduction 2011 Oct;17(10):626-36
Molecular human reproduction 2011 Oct;17(10):626-36
Bone and bone marrow pro-osteoclastogenic cytokines are up-regulated in osteoporosis fragility fractures.
D'Amelio P, Roato I, D'Amico L, Veneziano L, Suman E, Sassi F, Bisignano G, Ferracini R, Gargiulo G, Castoldi F, Pescarmona GP, Isaia GC
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA 2011 Nov;22(11):2869-77
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA 2011 Nov;22(11):2869-77
Carbonic anhydrase IX (CA9) modulates tumor-associated cell migration and invasion.
Shin HJ, Rho SB, Jung DC, Han IO, Oh ES, Kim JY
Journal of cell science 2011 Apr 1;124(Pt 7):1077-87
Journal of cell science 2011 Apr 1;124(Pt 7):1077-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DKK1 monoclonal antibody (M11), clone 2A5 Western Blot analysis of DKK1 expression in U-2 OS ( Cat # L022V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DKK1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of DKK1 transfected lysate using anti-DKK1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with DKK1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to DKK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol