HPA003739

WIPF1 antibody from Sigma-Aldrich
WASPIP, WIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003739, RRID:AB_1858783
Product name
Anti-WIPF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003739
Antibody type
Polyclonal
Antigen
WAS/WASL-interacting protein family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPR
PPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEW
ESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESR
SGSNRRERGAP
Storage
-20C
Provider Type Product Number
- No reagents -