HPA029633

antibody from Atlas Antibodies

Targeting: SNAP91 AP180, CALM, KIAA0656

Antibody data

Submit

Validation data

Product number: HPA029633 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029633, RRID:AB_10794615
Product name: Anti-SNAP91
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: APSEGSAEAAPELDLFAMKPPETSVPVVTPTASTA PPVPATAPSPAPAVAAAAAATTAATAAATTTTTTS AATATTAPPALDIFGDLFESTP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SNAP91 protein structure - HPA029633 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, liver and lymph node using Anti-SNAP91 antibody HPA029633 (A) shows similar protein distribution across tissues to independent antibody HPA029632 (B).
Antibody #2 product nr: HPA029632
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells and strong staining in neuropil.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SNAP91 antibody HPA029633.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SNAP91 antibody HPA029633.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-SNAP91 antibody HPA029633.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SNAP91 antibody HPA029633.
Sample type: HUMAN