Antibody data

Product number
H00006184-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006184-M03, RRID:AB_1580264
Product name
RPN1 monoclonal antibody (M03), clone 4B1-1E6
Provider product page
Abnova Corporation - H00006184-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RPN1.
Antigen sequence
ASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHL
GGGSTSRATSFLLALEPELEARLAHLGVQVKGEDE
EENNLEVRETKIKGKSGRFFTVKLPVALDPGAKIS
VIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFY
SPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLL
DYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRV
IEVSHWGNIAVEENVDLKHTGAVLKGPFSRYDYQR
QPDSGISSIRSFKTILPAAAQDVYYRDEIGNVSTS
HLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPS
YEYLYNLGDQYALKMRFVDHVFDEQVIDSLTVKII
LPEGAKNIEIDSPYEISRAPDELHYTYLDTSGRPV
IVAYKKNLVEQHIQDIVVHYTFNKVLMLQEPLLVV
AAFYILFFTVIIYVRLDFSITKDPAAEARMKVACI
TEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLN
SGKKSLEAEHKALTSEIALLQSRLKTEGSDLCDRV
SEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYI
ENEKLISGKRQELVTKIDHILDAL
Isotype
IgG
Antibody clone number
4B1-1E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -