HPA000549

ARSF antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000549
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000549, RRID:AB_1845055
Product name
Anti-ARSF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000549
Antibody type
Polyclonal
Antigen
Arylsulfatase F precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGSVWKAHYVTPVFQPPASGGCYVTSLCRCFGEQV
TYHNPPLLFDLSRDPSESTPLTPATEPLHDFVIKK
VANALKEHQETIVPVTYQLSELNQGRTWLKPCCGV
FPFCLCDKEEEVSQPR
Storage
-20C
Provider Type Product Number
- No reagents -