ABIN503105
antibody from antibodies-online
Targeting: PLXNA2
FLJ11751, FLJ30634, KIAA0463, OCT, PLXN2
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503105 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Plexin A2 (Plxna2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PLXNA2 antibody: synthetic peptide directed towards the N terminal of human PLXNA2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGV
QYEMV SVLKDGSPIL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references No association between schizophrenia and polymorphisms of the PlexinA2 gene in Chinese Han Trios.
The Kallmann's syndrome variant (KSV) model of the schizophrenias.
Budel S, Shim SO, Feng Z, Zhao H, Hisama F, Strittmatter SM
Schizophrenia research 2008 Feb;99(1-3):365-6
Schizophrenia research 2008 Feb;99(1-3):365-6
The Kallmann's syndrome variant (KSV) model of the schizophrenias.
Cowen MA, Green M
Schizophrenia research 1993 Mar;9(1):1-10
Schizophrenia research 1993 Mar;9(1):1-10
No comments: Submit comment
No validations: Submit validation data