HPA020215

CACNA1D antibody from Sigma-Aldrich
CACH3, CACN4, CACNL1A2, Cav1.3, CCHL1A2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020215
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020215, RRID:AB_1845860
Product name
Anti-CACNA1D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020215
Antibody type
Polyclonal
Antigen
Voltage-dependent L-type calcium channel subunit alpha-1D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTW
SRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDD
SPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRR
QSSQEEVPSSPIFPHRTALPLHLMQQQIMAV
Storage
-20C
Provider Type Product Number
- No reagents -