Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000782-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000782-M01, RRID:AB_565526
- Product name
- CACNB1 monoclonal antibody (M01), clone 1G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CACNB1.
- Antigen sequence
FDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGD
PAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNK
ARYCAEGGGPVLGRNKNELEGWGRGVYIR- Isotype
- IgG
- Antibody clone number
- 1G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The beta 1 subunit of L-type voltage-gated Ca2+ channels independently binds to and inhibits the gating of large-conductance Ca2+-activated K+ channels.
Zou S, Jha S, Kim EY, Dryer SE
Molecular pharmacology 2008 Feb;73(2):369-78
Molecular pharmacology 2008 Feb;73(2):369-78
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CACNB1 expression in transfected 293T cell line by CACNB1 monoclonal antibody (M01), clone 1G6.Lane 1: CACNB1 transfected lysate(65.7 KDa).Lane 2: Non-transfected lysate.