HPA022275

MAP1B antibody from Atlas Antibodies
MAP5, PPP1R102
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA022275
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022275, RRID:AB_1853944
Product name
Anti-MAP1B
Provider product page
Atlas Antibodies - HPA022275
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVVEEHCASPEDKTLEVVSPSQSVTGSAGHTPYYQ
SPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENE
RASVSPMDEPVPDSESPIEKVLSPLRSPPLIGSES
AYESFLSADDKASGRGAESPFEEKSGKQGSPDQVS
PVSEMTST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -