ABIN404806
antibody from antibodies-online
Targeting: NCOA3
ACTR, AIB1, bHLHe42, CAGH16, KAT13B, p/CIP, RAC3, SRC-3, SRC3, TNRC16, TRAM-1
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404806 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Coactivator 3 (NCOA3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NCOA3 antibody: synthetic peptide directed towards the middle region of human NCOA3
- Description
- Affinity Purified
- Reactivity
- Human, Porcine
- Host
- Rabbit
- Antigen sequence
DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQR
GPLES KGHKKLLQLL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Protein expression and amplification of AIB1 in human urothelial carcinoma of the bladder and overexpression of AIB1 is a new independent prognostic marker of patient survival.
Luo JH, Xie D, Liu MZ, Chen W, Liu YD, Wu GQ, Kung HF, Zeng YX, Guan XY
International journal of cancer. Journal international du cancer 2008 Jun 1;122(11):2554-61
International journal of cancer. Journal international du cancer 2008 Jun 1;122(11):2554-61
No comments: Submit comment
No validations: Submit validation data