HPA024210

NCOA3 antibody from Sigma-Aldrich
ACTR, AIB1, bHLHe42, CAGH16, KAT13B, p/CIP, RAC3, SRC-3, SRC3, TNRC16, TRAM-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024210
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024210, RRID:AB_10602011
Product name
Anti-NCOA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024210
Antibody type
Polyclonal
Antigen
nuclear receptor coactivator 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHL
SDKESKESSVEGAENQRGPLESKGHKKLLQLLTCS
SDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSST
SGGVSSTSNMHGSLLQEKHRILHKLL
Storage
-20C
Provider Type Product Number
- No reagents -