HPA023779

EPHX2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023779
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023779, RRID:AB_1848216
Product name
Anti-EPHX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023779
Antibody type
Polyclonal
Antigen
Epoxide hydrolase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEA
ELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFV
NSPEEPSLSRMVTEEEIQFYVQQF
Storage
-20C
Provider Type Product Number
- No reagents -