Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001266-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001266-A01, RRID:AB_489530
- Product name
- CNN3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CNN3.
- Antigen sequence
DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLG
RQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSD
YQAEYPDEYHGEYQDDYPRDYQYSDQGIDY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Rock-dependent calponin 3 phosphorylation regulates myoblast fusion.
Calponin 3 regulates actin cytoskeleton rearrangement in trophoblastic cell fusion.
Shibukawa Y, Yamazaki N, Daimon E, Wada Y
Experimental cell research 2013 Mar 10;319(5):633-48
Experimental cell research 2013 Mar 10;319(5):633-48
Calponin 3 regulates actin cytoskeleton rearrangement in trophoblastic cell fusion.
Shibukawa Y, Yamazaki N, Kumasawa K, Daimon E, Tajiri M, Okada Y, Ikawa M, Wada Y
Molecular biology of the cell 2010 Nov 15;21(22):3973-84
Molecular biology of the cell 2010 Nov 15;21(22):3973-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CNN3 polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of CNN3 expression in HepG2 ( Cat # L019V1 ).