HPA002017

IDH3G antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002017
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002017, RRID:AB_1079096
Product name
Anti-IDH3G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002017
Antibody type
Polyclonal
Antigen
Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHK
SRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDIL
IVRENTEGEYSSLEHESVAGVVESLKIITKAKSLR
IAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQ
CCREVAA
Storage
-20C
Provider Type Product Number
- No reagents -