Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501338 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RAR-Related Orphan Receptor A (RORA) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Zebrafish
- Host
- Rabbit
- Antigen sequence
GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNN
TVYFD GKYASPDVFK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cytosolic aspartate aminotransferase, a new partner in adipocyte glyceroneogenesis and an atypical target of thiazolidinedione.
Tordjman J, Leroyer S, Chauvet G, Quette J, Chauvet C, Tomkiewicz C, Chapron C, Barouki R, Forest C, Aggerbeck M, Antoine B
The Journal of biological chemistry 2007 Aug 10;282(32):23591-602
The Journal of biological chemistry 2007 Aug 10;282(32):23591-602
No comments: Submit comment
No validations: Submit validation data