Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502660 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RAR-Related Orphan Receptor A (RORA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI
IPCKI CGDKSSGIHY- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cytosolic aspartate aminotransferase, a new partner in adipocyte glyceroneogenesis and an atypical target of thiazolidinedione.
Tordjman J, Leroyer S, Chauvet G, Quette J, Chauvet C, Tomkiewicz C, Chapron C, Barouki R, Forest C, Aggerbeck M, Antoine B
The Journal of biological chemistry 2007 Aug 10;282(32):23591-602
The Journal of biological chemistry 2007 Aug 10;282(32):23591-602
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Host: Rabbit Target Name: RORA Sample Tissue: Human Fetal Heart Antibody Dilution: 1.0 μg/mL