Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006421-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006421-M02, RRID:AB_535024
- Product name
- SFPQ monoclonal antibody (M02), clone 6D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SFPQ.
- Antigen sequence
EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGN
LPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIK
LESRALAEIAKAELDDTPMRGRQ- Isotype
- IgG
- Antibody clone number
- 6D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Novel snail1 target proteins in human colon cancer identified by proteomic analysis.
A cell-based screen for splicing regulators identifies hnRNP LL as a distinct signal-induced repressor of CD45 variable exon 4.
Combinatorial control of signal-induced exon repression by hnRNP L and PSF.
Larriba MJ, Casado-Vela J, Pendás-Franco N, Peña R, García de Herreros A, Berciano MT, Lafarga M, Casal JI, Muñoz A
PloS one 2010 Apr 20;5(4):e10221
PloS one 2010 Apr 20;5(4):e10221
A cell-based screen for splicing regulators identifies hnRNP LL as a distinct signal-induced repressor of CD45 variable exon 4.
Topp JD, Jackson J, Melton AA, Lynch KW
RNA (New York, N.Y.) 2008 Oct;14(10):2038-49
RNA (New York, N.Y.) 2008 Oct;14(10):2038-49
Combinatorial control of signal-induced exon repression by hnRNP L and PSF.
Melton AA, Jackson J, Wang J, Lynch KW
Molecular and cellular biology 2007 Oct;27(19):6972-84
Molecular and cellular biology 2007 Oct;27(19):6972-84
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SFPQ monoclonal antibody (M02), clone 6D7 Western Blot analysis of SFPQ expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SFPQ is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SFPQ on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SFPQ on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol