HPA017375

OTUD5 antibody from Sigma-Aldrich
DKFZp761A052, DUBA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017375
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017375, RRID:AB_1854844
Product name
Anti-OTUD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017375
Antibody type
Polyclonal
Antigen
OTU domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAASSGLEEWTSRSPRQRSSASSPEHPELHAELGM
KPPSPGTVLALAKPPSPCAPGTSSQFSAGADRATS
PLVSLYPALECRALIQQMSPSAFGLNDWDDDEILA
SVLAVSQQEYLD
Storage
-20C
Provider Type Product Number
- No reagents -