H00006373-D01P

CXCL11 antibody from Abnova Corporation
b-R1, H174, I-TAC, IP-9, SCYB11, SCYB9B

Antibody data

Product number
H00006373-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006373-D01P, RRID:AB_1573228
Product name
CXCL11 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00006373-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human CXCL11 protein.
Antigen sequence
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGP
GVKAVKVADIEKASIMYPSNNCDKIEVIITLKENK
GQRCLNPKSKQARLIIKKVERKNF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -