HPA021681

MSTN antibody from MilliporeSigma / Merck KGaA
GDF8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021681
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021681, RRID:AB_1854263
Product name
Anti-MSTN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021681
Antibody type
Polyclonal
Antigen
Growth/differentiation factor 8 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAV
TFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDC
Storage
-20C
Provider Type Product Number
- No reagents -