HPA000841

TXLNG antibody from Atlas Antibodies
CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX

Antibody data

Product number
HPA000841
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000841, RRID:AB_1078589
Product name
Anti-TXLNG
Provider product page
Atlas Antibodies - HPA000841
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSPAYCTQESREEIPGGEARTDPPDGQQDSECNRN
KEKTLGKEVLLLMQALNTLSTPEEKLAALCKKYAD
LLEESRSVQKQMKILQKKQAQIVKEKVHLQSEHSK
AILARSKLESLCRELQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.