HPA000841
antibody from Atlas Antibodies
Targeting: TXLNG
CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000841 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000841, RRID:AB_1078589
- Product name
- Anti-TXLNG
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VSPAYCTQESREEIPGGEARTDPPDGQQDSECNRN
KEKTLGKEVLLLMQALNTLSTPEEKLAALCKKYAD
LLEESRSVQKQMKILQKKQAQIVKEKVHLQSEHSK
AILARSKLESLCRELQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tissue profiling of the mammalian central nervous system using human antibody-based proteomics.
Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1612-22
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines HEK293 and MCF-7 using Anti-TXLNG antibody. Corresponding TXLNG RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows distinct cytoplasmic positivity in subsets of bone marrow poietic cells.
- Sample type
- HUMAN