HPA000297

TXLNG antibody from Sigma-Aldrich
CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000297
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000297, RRID:AB_1078590
Product name
Anti-CXorf15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000297
Antibody type
Polyclonal
Antigen
gamma-Taxilin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQ
TERNELNEKVEVLKEQVSIKAAIKAANRDLATPVM
QPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAV
QKPPSTGSAP
Storage
-20C
Provider Type Product Number
- No reagents -