Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002776-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002776-M04, RRID:AB_1237721
- Product name
- GNAQ monoclonal antibody (M04), clone 3B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GNAQ.
- Antigen sequence
YKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSL
WNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADP
AYLPTQQDVLRVRVPTTGIIEYPFDLQSVI- Isotype
- IgG
- Antibody clone number
- 3B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Protein Kinase C ζ Interacts with a Novel Binding Region of Gαq to Act as a Functional Effector.
Sánchez-Fernández G, Cabezudo S, Caballero Á, García-Hoz C, Tall GG, Klett J, Michnick SW, Mayor F Jr, Ribas C
The Journal of biological chemistry 2016 Apr 29;291(18):9513-25
The Journal of biological chemistry 2016 Apr 29;291(18):9513-25
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GNAQ monoclonal antibody (M04), clone 3B9. Western Blot analysis of GNAQ expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GNAQ is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol