Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00004811-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00004811-M01, RRID:AB_1578041
 - Product name
 - NID1 monoclonal antibody (M01), clone 1G3
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant NID1.
 - Antigen sequence
 EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISK
ETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNG
GCTHLCLATPGSRTCRCPDNTLGVDCIERK- Isotype
 - IgG
 - Antibody clone number
 - 1G3
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of NID1 expression in transfected 293T cell line by NID1 monoclonal antibody (M01), clone 1G3.Lane 1: NID1 transfected lysate(122.1 KDa).Lane 2: Non-transfected lysate.
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged NID1 is 1 ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol