Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503576 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GNA12 antibody: synthetic peptide directed towards the middle region of human GNA12
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDN LDRIGQLNYF- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Examination of chromosome 7p22 candidate genes RBaK, PMS2 and GNA12 in familial hyperaldosteronism type II.
Jeske YW, So A, Kelemen L, Sukor N, Willys C, Bulmer B, Gordon RD, Duffy D, Stowasser M
Clinical and experimental pharmacology & physiology 2008 Apr;35(4):380-5
Clinical and experimental pharmacology & physiology 2008 Apr;35(4):380-5
No comments: Submit comment
No validations: Submit validation data