Antibody data

Product number
ABIN503576
Provider
antibodies-online
Product name
anti-Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12) (Middle Region) antibody
Provider product page
antibodies-online - ABIN503576
Antibody type
Polyclonal
Antigen
The immunogen for anti-GNA12 antibody: synthetic peptide directed towards the middle region of human GNA12
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDN LDRIGQLNYF
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -