H00004192-B02P

MDK antibody from Abnova Corporation
FLJ27379, MK, NEGF2

Antibody data

Product number
H00004192-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004192-B02P, RRID:AB_1577288
Product name
MDK purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00004192-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MDK protein.
Antigen sequence
MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGS
ECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC
RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQG
TLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK
GKD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -