Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004192-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004192-D01, RRID:AB_10721190
- Product name
- MDK MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human MDK protein.
- Antigen sequence
MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGS
ECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC
RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQG
TLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK
GKD- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MDK expression in transfected 293T cell line (H00004192-T03) by MDK MaxPab polyclonal antibody.Lane 1: MDK transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of MDK transfected lysate using anti-MDK MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MDK purified MaxPab mouse polyclonal antibody (B02P) (H00004192-B02P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol