HPA026685

SH3GL2 antibody from Sigma-Aldrich
CNSA2, EEN-B1, SH3D2A, SH3P4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026685
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026685, RRID:AB_1856817
Product name
Anti-SH3GL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026685
Antibody type
Polyclonal
Antigen
Endophilin-A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQP
RREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPS
GVQMDQPCCRALYDFEPENEGELG
Storage
-20C
Provider Type Product Number
- No reagents -