Antibody data

Product number
H00001478-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001478-M02, RRID:AB_1136919
Product name
CSTF2 monoclonal antibody (M02), clone 4E3-3C9
Provider product page
Abnova Corporation - H00001478-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CSTF2.
Antigen sequence
MAGLTVRDPAVDRSLRSVFVGNIPYEATEGQLKDI
FSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETA
LNAMRNLNGREFSGRALRVDNAASEKNKEELKSLG
TGAPVIESPYGETISPEDAPESISKAVASLPPEQM
FELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQA
QVVMRIVDPEIALKILHRQTNIPTLIAGNPQPVHG
AGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPL
MQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQA
QVGMPGSGPVSMERGQVPMQDPRAAMQRGSLPANV
PTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP
HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMA
EPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM
EARGLDARGLEARAMEARAMEARAMEARAMEARAM
EVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINM
GAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSP
GQNQVTPQDHEKAALIMQVLQLTADQIAMLPPEQR
QSILILKEQIQKSTGAP
Isotype
IgG
Antibody clone number
4E3-3C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -