H00003925-M01A
antibody from Abnova Corporation
Targeting: STMN1
C1orf215, FLJ32206, Lag, LAP18, OP18, PP17, PP19, PR22, SMN
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003925-M01A - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003925-M01A, RRID:AB_1016924
- Product name
- STMN1 monoclonal antibody (M01A), clone 3A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STMN1.
- Antigen sequence
PKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAE
KREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANK
ENREAQMAAKLERLREKDKHIEEVRKNKESKDPAD
ETEAD- Isotype
- IgM
- Antibody clone number
- 3A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of STMN1 expression in transfected 293T cell line by STMN1 monoclonal antibody (M01A), clone 3A9.Lane 1: STMN1 transfected lysate (Predicted MW: 17.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of STMN1 transfected lysate using anti-STMN1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with STMN1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol