HPA049158

TFPI2 antibody from Atlas Antibodies
PP5, REF1, TFPI-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA049158
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049158, RRID:AB_2680659
Product name
Anti-TFPI2
Provider product page
Atlas Antibodies - HPA049158
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ
CEGSTEKYFFNLSSMTCE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -