Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN629566 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tissue Factor Pathway Inhibitor 2 (TFPI2) antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant human TFPI-2 domain 1 produced in non-transgenic plants using a peptide corresponding to amino acids, HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV
- Description
- Protein G affinity chromatography
- Reactivity
- Human
- Host
- Rabbit
- Vial size
- 100 μg
- Storage
- Aliquot and store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles.
No comments: Submit comment
No validations: Submit validation data