Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB18936 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB18936, RRID:AB_10774045
- Product name
- TFPI2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant TFPI2.
- Antigen sequence
GAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY
TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKV
PKV- Storage
- Store at -20°C on dry atmosphere.After reconstitution with 100 uL distilled water, store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of 250 ng recombinant TFPI2 protein with TFPI2 polyclonal antibody (Cat # PAB18936) at 1 : 500 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of 100 ng recombinant recombinant Kunitz domain 1 from TFPI2 in plants with TFPI2 polyclonal antibody (Cat # PAB18936) at 1:500 dilution.