AMAb91091

LAMA1 antibody from Atlas Antibodies
LAMA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
AMAb91091
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#AMAb91091, RRID:AB_2665796
Product name
Anti-LAMA1
Provider product page
Atlas Antibodies - AMAb91091
Antibody type
Monoclonal
Reactivity
Human
Host
Mouse
Conjugate
Unconjugated
Antigen sequence
LIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLL
WSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHATEF
QRLADVLYSGLENIRNVSLNATSAA
Epitope
Binds to an epitope located within the peptide sequence DALEHLEDHQ as determined by overlapping synthetic peptides.
Isotype
IgG
Antibody clone number
CL2968
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -