Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502508 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ATP2C1 antibody: synthetic peptide directed towards the C terminal of human ATP2C1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPL
QKVFQ TESLSILGLA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel deletion mutation of the ATP2C1 gene in Chinese patients with Hailey-Hailey disease.
Li XL, Peng ZH, Xiao SX, Wang ZH, Liu Y, Pan M, Zhou SN, Luo SJ
Journal of the European Academy of Dermatology and Venereology : JEADV 2008 Feb;22(2):253-4
Journal of the European Academy of Dermatology and Venereology : JEADV 2008 Feb;22(2):253-4
No comments: Submit comment
No validations: Submit validation data