HPA000428

RENBP antibody from Atlas Antibodies
RBP, RNBP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000428
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000428, RRID:AB_611739
Product name
Anti-RENBP
Provider product page
Atlas Antibodies - HPA000428
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPG
HTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFH
SGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHS
EAMIA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -