HPA000522

RENBP antibody from Sigma-Aldrich
RBP, RNBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000522
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000522, RRID:AB_1079798
Product name
Anti-RENBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000522
Antibody type
Polyclonal
Antigen
N-Acylglucosamine 2-epimerase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DMEKERETLQAWKERVGQELDRVVAFWMEHSHDQE
HGGFFTCLGREGRVYDDLKYVWLQGRQVWMYCRLY
RTFERFRHAQLLDAAKAGGEFLLRYARVAPPGKKC
AFVLTRDGRPVKVQRTIFSE
Storage
-20C
Provider Type Product Number
- No reagents -