ABIN635028

antibody from antibodies-online

Targeting: MARCO SCARA2, SR-A6

Western blot

Antibody data

Submit

Validation data

Product number: ABIN635028 - Provider product page
Provider: antibodies-online
Product name: anti-Macrophage Receptor with Collagenous Structure (MARCO) (N-Term) antibody
Antibody type: Polyclonal
Antigen: MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: N-Term
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MARCO protein structure - ABIN635028 shown in red.