Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29510 - Provider product page

- Provider
- Abnova Corporation
- Product name
- ZC3H12B polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human ZC3H12B.
- Antigen sequence
GRALVMTRMDSISDSRLYESNPVRQRRPPLCREQH
ASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVR
SVPEKMEQLWRNPWVGMCNDSREHMIPEHQYQTYK
NLCN- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp, Lane 3: Human cell line A-431, Lane 4: Human liver tissue, Lane 5: Human tonsil tissue with ZC3H12B polyclonal antibody (Cat # PAB29510).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human tonsil with ZC3H12B polyclonal antibody (Cat # PAB29510) shows distinct cytoplasmic positivity in subsets of cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)