HPA000836

ZC3H12B antibody from Atlas Antibodies
CXorf32, MCPIP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000836
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000836, RRID:AB_611570
Product name
Anti-ZC3H12B
Provider product page
Atlas Antibodies - HPA000836
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GRALVMTRMDSISDSRLYESNPVRQRRPPLCREQH
ASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVR
SVPEKMEQLWRNPWVGMCNDSREHMIPEHQYQTYK
NLCN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -