HPA000836

ZC3H12B antibody from Atlas Antibodies
CXorf32, MCPIP2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000836
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000836, RRID:AB_2217374
Product name
Anti-ZC3H12B
Provider product page
Atlas Antibodies - HPA000836
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GRALVMTRMDSISDSRLYESNPVRQRRPPLCREQH
ASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVR
SVPEKMEQLWRNPWVGMCNDSREHMIPEHQYQTYK
NLCN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -