HPA000836

ZC3H12B antibody from Sigma-Aldrich
CXorf32, MCPIP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000836
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000836, RRID:AB_2217374
Product name
Anti-ZC3H12B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000836
Antibody type
Polyclonal
Antigen
Protein ZC3H12B
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GRALVMTRMDSISDSRLYESNPVRQRRPPLCREQH
ASWDPLPCTTDSYGYHSYPLSNSLMQPCYEPVMVR
SVPEKMEQLWRNPWVGMCNDSREHMIPEHQYQTYK
NLCN
Storage
-20C
Provider Type Product Number
- No reagents -