H00001432-B01P

MAPK14 antibody from Abnova Corporation
CSBP1, CSBP2, CSPB1, Mxi2, p38, PRKM14, PRKM15

Antibody data

Product number
H00001432-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001432-B01P, RRID:AB_1577762
Product name
MAPK14 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00001432-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MAPK14 protein.
Antigen sequence
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAY
GSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR
ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLV
THLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY
IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT
DDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG
CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAE
LLKKISSESARNYIQSLTQMPKMNFANVFIGANPL
AVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPD
DEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP
PPLDQEEMES
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -