Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004094-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004094-M02, RRID:AB_1111956
- Product name
- MAF monoclonal antibody (M02), clone 6B8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAF.
- Antigen sequence
SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLV
RERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFI
TEPTRKLEPSVGYATFWKPQHRVLTSVFTK- Isotype
- IgG
- Antibody clone number
- 6B8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TACI expression is associated with a mature bone marrow plasma cell signature and C-MAF overexpression in human myeloma cell lines.
Moreaux J, Hose D, Jourdan M, Reme T, Hundemer M, Moos M, Robert N, Moine P, De Vos J, Goldschmidt H, Klein B
Haematologica 2007 Jun;92(6):803-11
Haematologica 2007 Jun;92(6):803-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MAF monoclonal antibody (M02), clone 6B8. Western Blot analysis of MAF expression in PC-12 ( Cat # L012V1 ).