Antibody data

Product number
ABIN617048
Provider
antibodies-online
Product name
anti-Interleukin 5 (IL5) (Middle Region) antibody
Provider product page
antibodies-online - ABIN617048
Antibody type
Polyclonal
Antigen
The immunogen for anti-Il5 antibody: synthetic peptide corresponding to a region of Mouse
Description
Affinity Purified
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPT
HKNHQ LCIGEIFQGL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -