Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002255-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002255-M05, RRID:AB_606237
- Product name
- FGF10 monoclonal antibody (M05), clone 3C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FGF10.
- Antigen sequence
QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNH
LQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCP
YSILEITSVEIGVVAVKAINSNYYLAMNKK- Isotype
- IgG
- Antibody clone number
- 3C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between FGFR2 and FGF10. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF10 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)