Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000285 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000285, RRID:AB_1079619
- Product name
- Anti-PIM2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPA
TVWSLGILLYDMVCGDIPFERDQEILEAELHFPAH
VSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTP
AEDVPLNPSKGGPAPLAWSL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of targetable kinases in idiopathic pulmonary fibrosis
Positive regulation of PFKFB3 by PIM2 promotes glycolysis and paclitaxel resistance in breast cancer
PIM kinases are progression markers and emerging therapeutic targets in diffuse large B-cell lymphoma
Pim-selective inhibitor DHPCC-9 reveals Pim kinases as potent stimulators of cancer cell migration and invasion.
Higo H, Ohashi K, Tomida S, Okawa S, Yamamoto H, Sugimoto S, Senoo S, Makimoto G, Ninomiya K, Nakasuka T, Nishii K, Taniguchi A, Kubo T, Ichihara E, Hotta K, Miyahara N, Maeda Y, Toyooka S, Kiura K
Respiratory Research 2022;23(1)
Respiratory Research 2022;23(1)
Positive regulation of PFKFB3 by PIM2 promotes glycolysis and paclitaxel resistance in breast cancer
Lu C, Qiao P, Sun Y, Ren C, Yu Z
Clinical and Translational Medicine 2021;11(4)
Clinical and Translational Medicine 2021;11(4)
PIM kinases are progression markers and emerging therapeutic targets in diffuse large B-cell lymphoma
Brault L, Menter T, Obermann E, Knapp S, Thommen S, Schwaller J, Tzankov A
British Journal of Cancer 2012;107(3):491-500
British Journal of Cancer 2012;107(3):491-500
Pim-selective inhibitor DHPCC-9 reveals Pim kinases as potent stimulators of cancer cell migration and invasion.
Santio NM, Vahakoski RL, Rainio EM, Sandholm JA, Virtanen SS, Prudhomme M, Anizon F, Moreau P, Koskinen PJ
Molecular cancer 2010 Oct 19;9:279
Molecular cancer 2010 Oct 19;9:279
No comments: Submit comment
No validations: Submit validation data