HPA000285

PIM2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000285
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000285, RRID:AB_1079619
Product name
Anti-PIM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000285
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase Pim-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPA
TVWSLGILLYDMVCGDIPFERDQEILEAELHFPAH
VSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTP
AEDVPLNPSKGGPAPLAWSL
Storage
-20C
Provider Type Product Number
- No reagents -