HPA021555

antibody from Atlas Antibodies

Targeting: JAG1 AGS, AHD, AWS, CD339, HJ1, JAGL1

Antibody data

Submit

Validation data

Product number: HPA021555 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA021555, RRID:AB_1851969
Product name: Anti-JAG1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIE KHGANTVPIKDYENKNSKMSKIRTHNSEVEEDDMD KHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWT NKQDNRDLESAQSLNRMEYI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

JAG1 protein structure - HPA021555 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and lymph node tissues using HPA021555 antibody. Corresponding JAG1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows no cytoplasmic positivity in non-germinal center cells as expected.
Sample type: HUMAN